PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00048048-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 637aa    MW: 70056.1 Da    PI: 6.6652
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00048048-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.88.7e-12454513564
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                       kr +r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l  l+  +a l s+++
  PSME_00048048-RA 454 KRVKRILANRQSAARSKERKMRYISELERKVQTLQTEATTLSAQLTLLQRDSAGLGSQNH 513
                       8999************************************************99999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-18450514IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749452515IPR004827Basic-leucine zipper domain
PfamPF001709.5E-10454512IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-11454510No hitNo description
SuperFamilySSF579595.34E-11454505No hitNo description
CDDcd147033.88E-24455506No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MEDMDNSYGD LMQRLQSSMG TSSSFIPKQQ LNKSEPSSPA ISQTRPPFTA NIQNFSLGSK  60
RQGIPPSHPH FPPTSPHSQA FFNQMPVLQS PVQQNSQNQQ HSNATHTTLH SRSMSQPPIF  120
NLDSLPPLNP CSYRDPSSPS MSDPVSGDVS MEDQEGSSAL PSLSPHNPPP LFPSGRRSQN  180
QMSDGLPPRK GHRRARSDNP FTFMSGSQSL SGDIQQGFAS SLETSSVKGA AQIDHLNQYV  240
SSLDREKTKA QVVKAELNQE RNGIQNVESM GEGETGREAG EDMVSGCIDV EKMNNLNKPR  300
LASGEMPDNL NGVQEDSGGS SVKQKNLKDG DQFSSSDEAD SEVNEFNIMK RSNSGVGYEE  360
NKSAGQGDGS QYLNRSRHSR SVSMDSIMSK MHSFSDDLEQ EPSQGRNVRH SHSNSMDGST  420
SFNVEFGNGE FSASEMKKIM ASEKLAELAT VDPKRVKRIL ANRQSAARSK ERKMRYISEL  480
ERKVQTLQTE ATTLSAQLTL LQRDSAGLGS QNHELKLRLQ AMEQQAQLRD ALNEALAEEV  540
QRLKLATGQL GAGQSGSLAQ QMSMNSPLFQ LQQQGPPHPL YQLQQQHQQQ QQQQHQVKYS  600
QQPPGQQTNR NEVRQTTYSS LPGPVGSSSK PDNSNEC
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1048780.0BT104878.1 Picea glauca clone GQ02816_C17 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263926.11e-141PREDICTED: probable serine/threonine-protein kinase mps1
STRINGVIT_03s0038g00860.t011e-131(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-73bZIP family protein